PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT09741
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 375aa    MW: 40729.9 Da    PI: 8.3124
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT09741genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof114.83.7e-36125182461
    zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
               + l+cprCdstntkfCy+nnysl+qPr+fC++CrryWt+GG lrnvPvGgg r++ k+
  EMT09741 125 SGLNCPRCDSTNTKFCYFNNYSLTQPRHFCRSCRRYWTHGGMLRNVPVGGGYRRHAKR 182
               5689***********************************************9998665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074787.0E-33113181IPR003851Zinc finger, Dof-type
PfamPF027011.5E-31127181IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.5127181IPR003851Zinc finger, Dof-type
PROSITE patternPS013610129165IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 375 aa     Download sequence    Send to blast
MICLPAFPDS SNFWNTDHNQ LQLQQFGTNN HSTTTFSPAS PSDGECSNNN NNNNNNNNNN  60
NNNNNNNNNN QKRFMAMAKA GSCAAGGGDD GCGGVGDGDC GGNGKSKSMS MSERARLARL  120
PQPVSGLNCP RCDSTNTKFC YFNNYSLTQP RHFCRSCRRY WTHGGMLRNV PVGGGYRRHA  180
KRRAKPKVVS DTSRAAMVGT SSVTSTMSSS TTYVTGTGTA PPRLQYPMFG STPSHDNQFV  240
DSFDPANIGL SFPIRLLFAD SDAYAMDDCA QNHHHHAHGN GMEQLSATRN SFPFIHVVDH  300
QMSGLPAEAM PITMAAMEGM FHLGLQSVGG ATGDEIGGQQ LHHPLTKRNH KRQDYPSSRG  360
MYRDVVNGNC GGDYI
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8B7100.0M8B710_AEGTA; Dof zinc finger protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.13e-38OBF-binding protein 3